![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5AL_69C653611.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 67aa MW: 7983.9 Da PI: 5.0974 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 36.9 | 1.2e-11 | 25 | 66 | 1 | 42 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkre 42 +fYn+YA+e GFsvrks+ + n+ i+ r+ vCs++g+re Traes_5AL_69C653611.1 25 EFYNKYAREKGFSVRKSYVEWDGSNKYIIIRKIVCSRQGFRE 66 6***************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 3.1E-9 | 25 | 66 | IPR004330 | FAR1 DNA binding domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 67 aa Download sequence Send to blast |
ASDESMFEYV NVVSKMFDSE AEGYEFYNKY AREKGFSVRK SYVEWDGSNK YIIIRKIVCS 60 RQGFRED |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 7e-99 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002456168.1 | 5e-22 | hypothetical protein SORBIDRAFT_03g031563, partial | ||||
Refseq | XP_002466791.1 | 2e-21 | hypothetical protein SORBIDRAFT_01g014270 | ||||
TrEMBL | W5EXY3 | 6e-42 | W5EXY3_WHEAT; Uncharacterized protein | ||||
STRING | Sb01g014270.1 | 5e-21 | (Sorghum bicolor) | ||||
STRING | Sb03g031563.1 | 1e-21 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2449 | 9 | 76 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G28530.1 | 1e-07 | FAR1-related sequence 10 |
Publications ? help Back to Top | |||
---|---|---|---|
|